ALG11 Antibody - C-terminal region (ARP44463_P050)

Data Sheet
 
Product Number ARP44463_P050
Product Page www.avivasysbio.com/alg11-antibody-c-terminal-region-arp44463-p050.html
Name ALG11 Antibody - C-terminal region (ARP44463_P050)
Gene Symbol ALG11
Alias Symbols GT8, KIAA0266, CDG1P
Protein Size (# AA) 492 amino acids
Molecular Weight 56kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 440138
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast)
Peptide Sequence Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
Target Reference Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Description of Target The function remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ALG11 (ARP44463_P050) antibody
Blocking Peptide For anti-ALG11 (ARP44463_P050) antibody is Catalog # AAP44463 (Previous Catalog # AAPP25773)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ALG11
Complete computational species homology data Anti-ALG11 (ARP44463_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ALG11.
Swissprot Id Q2TAA5
Protein Name GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
Publications

Rind, N. et al. A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip. Hum. Mol. Genet. 19, 1413-24 (2010). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 20080937

Protein Accession # NP_001004127
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ALG11.
Nucleotide Accession # NM_001004127
Replacement Item This antibody may replace item sc-105053 from Santa Cruz Biotechnology.
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Yeast: 92%; Zebrafish: 91%
Image 1
Human HepG2
WB Suggested Anti-ALG11 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Image 2
Human kidney
Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com