Product Number |
ARP44448_P050 |
Product Page |
www.avivasysbio.com/ucrc-antibody-middle-region-arp44448-p050.html |
Name |
UCRC Antibody - middle region (ARP44448_P050) |
Protein Size (# AA) |
63 amino acids |
Molecular Weight |
7kDa |
Subunit |
9 |
NCBI Gene Id |
29796 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Ubiquinol-cytochrome c reductase, complex III subunit X |
Alias Symbols |
QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2 |
Peptide Sequence |
Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Guzy,R.D., (2005) Cell Metab. 1 (6), 401-408 |
Description of Target |
UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM]. |
Protein Interactions |
CYSTM1; RAB11A; HNRNPM; MOV10; UBC; UQCR11; UQCRFS1; UQCRC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-UQCR10 (ARP44448_P050) antibody |
Blocking Peptide |
For anti-UQCR10 (ARP44448_P050) antibody is Catalog # AAP44448 (Previous Catalog # AAPP25758) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human UCRC |
Uniprot ID |
Q9UDW1 |
Protein Name |
Cytochrome b-c1 complex subunit 9 |
Sample Type Confirmation |
UQCR10 is supported by BioGPS gene expression data to be expressed in MCF7 |
Protein Accession # |
NP_037519 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_013387 |
Tested Species Reactivity |
Human |
Gene Symbol |
UQCR10 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100% |
Image 1 | Human MCF-7
| WB Suggested Anti-UCRC Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: MCF7 cell lysateUQCR10 is supported by BioGPS gene expression data to be expressed in MCF7 |
|
Image 2 | Human Bronchial Epithelial Tissue
| Rabbit Anti-UQCR10 Antibody Catalog Number: ARP44448_P050 Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|