UCRC Antibody - middle region (ARP44448_P050)

Data Sheet
 
Product Number ARP44448_P050
Product Page www.avivasysbio.com/ucrc-antibody-middle-region-arp44448-p050.html
Name UCRC Antibody - middle region (ARP44448_P050)
Protein Size (# AA) 63 amino acids
Molecular Weight 7kDa
Subunit 9
NCBI Gene Id 29796
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ubiquinol-cytochrome c reductase, complex III subunit X
Alias Symbols QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2
Peptide Sequence Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Guzy,R.D., (2005) Cell Metab. 1 (6), 401-408
Description of Target UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM].
Protein Interactions CYSTM1; RAB11A; HNRNPM; MOV10; UBC; UQCR11; UQCRFS1; UQCRC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-UQCR10 (ARP44448_P050) antibody
Blocking Peptide For anti-UQCR10 (ARP44448_P050) antibody is Catalog # AAP44448 (Previous Catalog # AAPP25758)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UCRC
Uniprot ID Q9UDW1
Protein Name Cytochrome b-c1 complex subunit 9
Sample Type Confirmation

UQCR10 is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_037519
Purification Affinity Purified
Nucleotide Accession # NM_013387
Tested Species Reactivity Human
Gene Symbol UQCR10
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
Image 1
Human MCF-7
WB Suggested Anti-UCRC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysateUQCR10 is supported by BioGPS gene expression data to be expressed in MCF7
Image 2
Human Bronchial Epithelial Tissue
Rabbit Anti-UQCR10 Antibody
Catalog Number: ARP44448_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com