Product Number |
ARP44434_P050 |
Product Page |
www.avivasysbio.com/fmo3-antibody-n-terminal-region-arp44434-p050.html |
Name |
FMO3 Antibody - N-terminal region (ARP44434_P050) |
Protein Size (# AA) |
532 amino acids |
Molecular Weight |
59kDa |
NCBI Gene Id |
2328 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Flavin containing monooxygenase 3 |
Description |
|
Alias Symbols |
TMAU, FMOII, dJ127D3.1 |
Peptide Sequence |
Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Zhang,J. (2006) Drug Metab. Dispos. 34 (1), 19-26 |
Description of Target |
FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FMO3 (ARP44434_P050) antibody |
Blocking Peptide |
For anti-FMO3 (ARP44434_P050) antibody is Catalog # AAP44434 (Previous Catalog # AAPP25744) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FMO3 |
Uniprot ID |
P31513 |
Protein Name |
Dimethylaniline monooxygenase [N-oxide-forming] 3 |
Protein Accession # |
NP_001002294 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001002294 |
Tested Species Reactivity |
Human |
Gene Symbol |
FMO3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-FMO3 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
Image 2 | Human Liver Tissue
| FMO3 antibody - N-terminal region (ARP44434_P050)
Catalog Number: ARP44434_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in sinusoids of liver
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|