Product Number |
ARP44362_P050 |
Product Page |
www.avivasysbio.com/por-antibody-middle-region-arp44362-p050.html |
Name |
POR Antibody - middle region (ARP44362_P050) |
Protein Size (# AA) |
680 amino acids |
Molecular Weight |
77 kDa |
NCBI Gene Id |
5447 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
P450 (cytochrome) oxidoreductase |
Alias Symbols |
CPR, CYPOR, P450R |
Peptide Sequence |
Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gomes,L.G., (er) J. Clin. Endocrinol. Metab. (2008) In press |
Description of Target |
POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
UBC; CYP2C9; PGRMC1; STAT1; INSIG1; CYP3A4; CYP2E1; CYP2D6; CYP2C19; CYP2A6; CYP1A2; UBD; SUMO2; RABEPK; FANCC; CYB5A; CYP17A1; XRCC6; HMOX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-POR (ARP44362_P050) antibody |
Additional Information |
IHC Information: Transfected 293T cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 12%. |
Blocking Peptide |
For anti-POR (ARP44362_P050) antibody is Catalog # AAP44362 (Previous Catalog # AAPS14810) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human POR |
Uniprot ID |
Q63HL4 |
Protein Name |
NADPH--cytochrome P450 reductase PIRNR PIRNR000208 |
Publications |
Lee, J. W., Kim, Y. H., Yoon, S. & Lee, S. K. Cytochrome P450 system expression and DNA adduct formation in the liver of Zacco platypus following waterborne Benzo(a)pyrene exposure: implications for biomarker determination. Environ. Toxicol. (2012). doi:10.1002/tox.21833 23192953 |
Protein Accession # |
NP_000932 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000941 |
Tested Species Reactivity |
Human |
Gene Symbol |
POR |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | |
Image 2 | Human 293T
| WB Suggested Anti-POR Antibody Titration: 0.25ug/ml Positive Control: 293T cells lysate |
|
Image 3 | Human HCT116 Whole Cell
| Host: Rabbit Target Name: POR Sample Tissue: Human HCT116 Whole Cell Antibody Dilution: 3ug/ml |
|
Image 4 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|