KITLG Antibody - middle region (ARP44354_P050)

• Product Number: ARP44354_P050
• Name: KITLG Antibody - middle region (ARP44354_P050)
• Protein Size (# AA): 273 amino acids
• Molecular Weight: 28kDa
• NCBI Gene Id: 4254
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: KIT ligand
• Alias Symbols: SF, MGF, SCF, SLF, DCUA, FPH2, FPHH, KL-1, Kitl, SHEP7, DFNA69
• Peptide Sequence: Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kasamatsu,S., (2008) J. Invest. Dermatol. 128 (7), 1763-1772
• Description of Target: KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.This gene encodes the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: UBC; CLEC11A; UBE2V1; PIK3CD; FLT3LG; KITLG; KIT; CSF2; EPOR; CMA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Placenta
  IHC Information: Lung
• Blocking Peptide: For anti-KITLG (ARP44354_P050) antibody is Catalog # AAP44354 (Previous Catalog # AAPS14802)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KITLG
• Uniprot ID: P21583
• Protein Name: Kit ligand
• Protein Accession #: NP_000890
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000899
• Tested Species Reactivity: Human, Rat
• Gene Symbol: KITLG
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-KITLG Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: HepG2 cell lysate
• Image 2: Human lung, Human brain
  
  Host: Rabbit
  Target: KITLG
  Positive control (+): Human lung (LU)
  Negative control (-): Human brain (BR)
  Antibody concentration: 1ug/ml
• Image 3: Rat Skeletal Muscle
  
  Host: Rat
  Target Name: KITLG
  Sample Tissue: Rat Skeletal Muscle
  Antibody Dilution: 1ug/ml
• Image 4: Jurkat
  
  Host: Rabbit
  Target Name: KITLG
  Sample Type: Jurkat
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane/lane
  Gel Concentration: 0.12