GGCX Antibody - middle region (ARP44340_P050)

• Product Number: ARP44340_P050
• Name: GGCX Antibody - middle region (ARP44340_P050)
• Protein Size (# AA): 758 amino acids
• Molecular Weight: 87kDa
• NCBI Gene Id: 2677
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Gamma-glutamyl carboxylase
• Alias Symbols: VKCFD1
• Peptide Sequence: Synthetic peptide located within the following region: FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rieder,M.J., (2007) J. Thromb. Haemost. 5 (11), 2227-2234
• Description of Target: GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.Gamma-glutamyl carboxylase accomplishes the posttranslational modification required for the activity of all of the vitamin K-dependent proteins (Wu et al., 1991 [PubMed 1749935]). These include some of the blood coagulation and anticoagulation proteins as well as bone gamma-carboxyglutamic acid (Gla) protein (BGLAP; MIM 112260) and bone matrix protein (MGP; MIM 154870).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; DCP2; FBXO6; F9; F10; F7; F2; PROC; BGLAP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GGCX (ARP44340_P050) antibody is Catalog # AAP44340 (Previous Catalog # AAPS14612)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GGCX
• Uniprot ID: P38435
• Protein Name: Vitamin K-dependent gamma-carboxylase
• Sample Type Confirmation:

  GGCX is strongly supported by BioGPS gene expression data to be expressed in Jurkat, MCF7

• Protein Accession #: NP_000812
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000821
• Tested Species Reactivity: Human
• Gene Symbol: GGCX
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
• Image 1: Human Adult Liver
  
  Rabbit Anti-GGCX Antibody
  Catalog Number: ARP44340_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 2: Human Jurkat
  
  Host: Rabbit
  Target Name: GGCX
  Sample Type: Jurkat
  Antibody Dilution: 1.0ug/mlGGCX is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
• Image 3: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: GGCX
  Sample Tissue: Human 786-0 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 4: Human MCF-7
  
  WB Suggested Anti-GGCX Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: MCF7 cell lysate.GGCX is strongly supported by BioGPS gene expression data to be expressed in MCF7