| Product Number |
ARP44327_P050 |
| Product Page |
www.avivasysbio.com/comt-antibody-middle-region-arp44327-p050.html |
| Name |
COMT Antibody - middle region (ARP44327_P050) |
| Protein Size (# AA) |
271 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
1312 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Catechol-O-methyltransferase |
| Alias Symbols |
HEL-S-98n |
| Peptide Sequence |
Synthetic peptide located within the following region: PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Shiels,M.S., (2008) Prev Med 47 (1), 116-122 |
| Description of Target |
Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathwa |
| Protein Interactions |
KRT40; TRIP13; UBC; KRT31; KRTAP5-9; CDC27; RNF2; FBXO6; vpr; FN1; VKORC1; VCP; RGS2; LITAF; XRN2; ACE; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-COMT (ARP44327_P050) antibody |
| Blocking Peptide |
For anti-COMT (ARP44327_P050) antibody is Catalog # AAP44327 (Previous Catalog # AAPS14511) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human COMT |
| Uniprot ID |
P21964 |
| Protein Name |
Catechol O-methyltransferase |
| Protein Accession # |
NP_000745 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000754 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
COMT |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 79%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human, Mouse, Rat
 | COMT antibody - middle region (ARP44327_P050) validated by WB using rat liver, mouse lung, human brain at 1:1000. |
|
| Image 2 | Human lung microsome
 | Lanes:
1. 100 ug Human lung microsome lysate
Primary Antibody Dilution:
1: 1000
Secondary Antibody:
Secondary Antibody Dilution:
1: 10000
Gene Name:
COMT
Submitted by:
Jing Peng, Fox Chase Cancer Center
|
|
| Image 3 | Human Stomach
 | WB Suggested Anti-COMT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Stomach |
|
