| Product Number |
ARP44264_P050-FITC |
| Product Page |
www.avivasysbio.com/srd5a2-antibody-n-terminal-region-fitc-arp44264-p050-fitc.html |
| Name |
SRD5A2 Antibody - N-terminal region : FITC (ARP44264_P050-FITC) |
| Protein Size (# AA) |
254 amino acids |
| Molecular Weight |
28kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
6716 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) |
| Alias Symbols |
MGC138457 |
| Peptide Sequence |
Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SRD5A2 (ARP44264_P050-FITC) antibody |
| Blocking Peptide |
For anti-SRD5A2 (ARP44264_P050-FITC) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2 |
| Uniprot ID |
Q28892 |
| Protein Name |
3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
| Protein Accession # |
NP_000339 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000348 |
| Gene Symbol |
SRD5A2 |
| Predicted Species Reactivity |
Human, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 86%; Rabbit: 91% |
| Image 1 | |
|
