SRD5A2 Antibody - N-terminal region : FITC (ARP44264_P050-FITC)

Data Sheet
 
Product Number ARP44264_P050-FITC
Product Page www.avivasysbio.com/srd5a2-antibody-n-terminal-region-fitc-arp44264-p050-fitc.html
Product Name SRD5A2 Antibody - N-terminal region : FITC (ARP44264_P050-FITC)
Size 100 ul
Gene Symbol SRD5A2
Alias Symbols MGC138457
Protein Size (# AA) 254 amino acids
Molecular Weight 28kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
NCBI Gene Id 6716
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Official Gene Full Name Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
Peptide Sequence Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
Description of Target This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Tips Information

See our General FAQ page.

Datasheets/Manuals Printable datasheet for anti-SRD5A2 (ARP44264_P050-FITC) antibody
Protocol
The following related protocols are available on www.avivasysbio.com
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SRD5A2 (ARP44264_P050-FITC) antibody is Catalog # AAP44264 (Previous Catalog # AAPP25644)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SRD5A2
Complete computational species homology data Anti-SRD5A2 (ARP44264_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SRD5A2.
Swissprot Id Q28892
Protein Name 3-oxo-5-alpha-steroid 4-dehydrogenase 2
Protein Accession # NP_000339
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SRD5A2.
Nucleotide Accession # NM_000348
Replacement Item This antibody may replace item sc-20400 from Santa Cruz Biotechnology.
Predicted Species Reactivity Human, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 86%; Rabbit: 91%
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com