SHH Antibody - N-terminal region (ARP44235_P050)

Data Sheet
 
Product Number ARP44235_P050
Product Page www.avivasysbio.com/shh-antibody-n-terminal-region-arp44235-p050.html
Name SHH Antibody - N-terminal region (ARP44235_P050)
Protein Size (# AA) 462 amino acids
Molecular Weight 28 kDa
NCBI Gene Id 6469
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sonic hedgehog
Description
Alias Symbols TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Peptide Sequence Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Coon,D.R., (2006) Exp. Mol. Pathol. 80 (2), 119-123
Description of Target SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.
Protein Interactions UBC; SEL1L; DERL2; DERL1; SYVN1; HHIP; PTCH2; PTCH1; SHH; ADCYAP1; GAS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
SPR Affinity Characterization Avivasheild
Datasheets/Manuals Printable datasheet for anti-SHH (ARP44235_P050) antibody
Blocking Peptide For anti-SHH (ARP44235_P050) antibody is Catalog # AAP44235 (Previous Catalog # AAPP25615)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SHH
Uniprot ID Q15465
Protein Name Sonic hedgehog protein
Protein Accession # NP_000184
Purification Affinity Purified
Nucleotide Accession # NM_000193
Tested Species Reactivity Human, Mouse, Chicken
Gene Symbol SHH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish, Chicken
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Urinary Bladder
Rabbit Anti-SHH Antibody
Catalog Number: ARP44235_P050
Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue
Observed Staining: Plasma membrane, Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Mouse Brain
Host: Mouse
Target Name: SHH
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml
Image 3
Human glioma
Sample Type:
Human glioma cells
Primary Antibody Dilution:
1:200
Secondary Antibody:
Anti-rabbit-GFP
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
1. SHH: Green 2. DAPI: Blue 3. Merge
Gene Name:
SHH
Submitted by:
ELIAS EL HABR, PhD, Post-Doctoral fellow, INSERM U894 Glial Plasticity Team, Psychiatry& Neurosciences Center, St Anne Hospital, 2 Ter, Rue d'Alesia, 75014 Paris
Image 4
Chicken embryos
Chicken embryos
Primary antibody: 1:1000 (ARP44235_p050) anti -shh Secondary Antibody: 1:500 (ASP00001) goat anti-rabbit HRP conjugated
Image 5
Human Stomach Tumor
Host: Rabbit
Target Name: SHH
Sample Tissue: Human Stomach Tumor
Antibody Dilution: 1.0ug/ml
Image 6

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com