Product Number |
ARP44235_P050 |
Product Page |
www.avivasysbio.com/shh-antibody-n-terminal-region-arp44235-p050.html |
Name |
SHH Antibody - N-terminal region (ARP44235_P050) |
Protein Size (# AA) |
462 amino acids |
Molecular Weight |
28 kDa |
NCBI Gene Id |
6469 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sonic hedgehog |
Description |
|
Alias Symbols |
TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5 |
Peptide Sequence |
Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Coon,D.R., (2006) Exp. Mol. Pathol. 80 (2), 119-123 |
Description of Target |
SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities. |
Protein Interactions |
UBC; SEL1L; DERL2; DERL1; SYVN1; HHIP; PTCH2; PTCH1; SHH; ADCYAP1; GAS1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
SPR Affinity Characterization |
|
|
Datasheets/Manuals |
Printable datasheet for anti-SHH (ARP44235_P050) antibody |
Blocking Peptide |
For anti-SHH (ARP44235_P050) antibody is Catalog # AAP44235 (Previous Catalog # AAPP25615) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SHH |
Uniprot ID |
Q15465 |
Protein Name |
Sonic hedgehog protein |
Protein Accession # |
NP_000184 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000193 |
Tested Species Reactivity |
Human, Mouse, Chicken |
Gene Symbol |
SHH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish, Chicken |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Urinary Bladder
| Rabbit Anti-SHH Antibody Catalog Number: ARP44235_P050 Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue Observed Staining: Plasma membrane, Cytoplasm Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec |
|
Image 2 | Mouse Brain
| Host: Mouse Target Name: SHH Sample Tissue: Mouse Brain Antibody Dilution: 1ug/ml |
|
Image 3 | Human glioma
| Sample Type: Human glioma cellsPrimary Antibody Dilution: 1:200Secondary Antibody: Anti-rabbit-GFPSecondary Antibody Dilution: 1:500Color/Signal Descriptions: 1. SHH: Green 2. DAPI: Blue 3. MergeGene Name: SHHSubmitted by: ELIAS EL HABR, PhD, Post-Doctoral fellow, INSERM U894 Glial Plasticity Team, Psychiatry& Neurosciences Center, St Anne Hospital, 2 Ter, Rue d'Alesia, 75014 Paris |
|
Image 4 | Chicken embryos
| Chicken embryos
Primary antibody: 1:1000 (ARP44235_p050) anti -shh
Secondary Antibody: 1:500 (ASP00001) goat anti-rabbit HRP conjugated |
|
Image 5 | Human Stomach Tumor
| Host: Rabbit Target Name: SHH Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0ug/ml |
|
Image 6 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|