G6PC Antibody - N-terminal region (ARP44224_P050)

• Product Number: ARP44224_P050
• Name: G6PC Antibody - N-terminal region (ARP44224_P050)
• Protein Size (# AA): 357 amino acids
• Molecular Weight: 40 kDa
• NCBI Gene Id: 2538
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glucose-6-phosphatase, catalytic subunit
• Alias Symbols: G6PC, G6PT, GSD1, GSD1a, G6Pase
• Peptide Sequence: Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Barkaoui,E., J. Inherit. Metab. Dis. 30 (6), 989 (2007)
• Description of Target: G6PC hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum.It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.Glucose-6-phosphatase is an integral membrane protein of the endoplasmic reticulum that catalyzes the hydrolysis of D-glucose 6-phosphate to D-glucose and orthophosphate. It is a key enzyme in glucose homeostasis, functioning in gluconeogenesis and glycogenolysis. Defects in the enzyme cause glycogen storage disease type I (von Gierke disease). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: NSL1; SNX13; CDH16; FOXO1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Additional Information: IHC Information: Kidney, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-G6PC (ARP44224_P050) antibody is Catalog # AAP44224 (Previous Catalog # AAPP25604)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human G6PC
• Uniprot ID: P35575
• Protein Name: Glucose-6-phosphatase
• Publications:

  Iwasa, M. et al. Branched-chain amino acid supplementation reduces oxidative stress and prolongs survival in rats with advanced liver cirrhosis. PLoS One 8, e70309 (2013). 23936183

• Protein Accession #: NP_000142
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000151
• Tested Species Reactivity: Human
• Gene Symbol: G6PC
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 100%
• Image 1: Human kidney
  
  Immunohistochemistry with Human kidney lysate tissue
• Image 2: Human MCF7
  
  Host: Rabbit
  Target Name: G6PC
  Sample Tissue: Human MCF7
  Antibody Dilution: 1.0ug/ml
• Image 3: Human kidney, Human fetal heart
  
  Host: Rabbit
  Target: G6PC
  Positive control (+): Human kidney (KI)
  Negative control (-): Human fetal heart (HE)
  Antibody concentration: 1ug/ml
• Image 4: Normal human kidney
  
  Formalin Fixed Paraffin Embedded Tissue: Normal human kidney
  Primary antibody concentration: 7 ug/ml
  Incubation with primary antibodies: overnight at 4°C
  Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate.
  Counterstain: Hematoxylin
• Image 5: Normal human liver
  
  Formalin Fixed Paraffin Embedded Tissue: Normal human liver
  Primary antibody concentration: 7 ug/ml
  Incubation with primary antibodies: overnight at 4°C
  Detections: Avidin-Biotin-HRP with NovaRed (Vector Labs) substrate.
  Counterstain: Hematoxylin
• Image 6: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein is glycosylated.