G6pc Antibody - N-terminal region (ARP44223_P050)

• Product Number: ARP44223_P050
• Name: G6pc Antibody - N-terminal region (ARP44223_P050)
• Protein Size (# AA): 357 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 14377
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glucose-6-phosphatase, catalytic
• Description:
  View product citations for G6pc Antibody - N-terminal region (ARP44223_P050) on CiteAb
• Alias Symbols: G6P, G6pt, G6pc1, G6Pase, Glc-6-, AW107337, Glc-6-Pase
• Peptide Sequence: Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: G6pc hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It forms with the glucose-6-phosphate transporter (SLC37A4/G6PT) the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it is the key enzyme in homeostatic regulation of blood glucose levels.
• Protein Interactions: Ppargc1a; Foxo1; Sirt1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-G6pc (ARP44223_P050) antibody is Catalog # AAP44223 (Previous Catalog # AAPP25603)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: P35576
• Protein Name: Glucose-6-phosphatase
• Publications:

  Hepatocyte TRAF3 promotes liver steatosis and systemic insulin resistance through targeting TAK1-dependent signalling. Nat Commun. 7, 10592 (2016). 26882989

  Targeting CASP8 and FADD-like apoptosis regulator ameliorates nonalcoholic steatohepatitis in mice and nonhuman primates. Nat. Med. 23, 439-449 (2017). 28218919

• Protein Accession #: NP_032087
• Purification: Affinity Purified
• Nucleotide Accession #: NM_008061
• Tested Species Reactivity: Mouse
• Gene Symbol: G6pc
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 85%; Rat: 86%
• Image 1: Mouse Testis
  
  Host: Rabbit
  Target Name: G6PC
  Sample Tissue: Mouse Testis
  Antibody Dilution: 1ug/ml
• Image 2: Mouse Lung
  
  Host: Rabbit
  Target Name: G6pc
  Sample Tissue: Mouse Lung
  Antibody Dilution: 1.0ug/ml
• Image 3: Mouse Liver
  
  Host: Rabbit
  Target Name: G6PC
  Sample Tissue: Mouse Liver
  Antibody Dilution: 1ug/ml