| Product Number |
ARP44197_P050 |
| Product Page |
www.avivasysbio.com/nat2-antibody-middle-region-arp44197-p050.html |
| Name |
NAT2 Antibody - middle region (ARP44197_P050) |
| Protein Size (# AA) |
290 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
10 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
N-acetyltransferase 2 (arylamine N-acetyltransferase) |
| Description |
|
| Alias Symbols |
AAC2, PNAT, NAT-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity. |
| Protein Interactions |
APP; NAA10; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NAT2 (ARP44197_P050) antibody |
| Specificity |
Antibody reacts with both NAT1 and NAT2 |
| Blocking Peptide |
For anti-NAT2 (ARP44197_P050) antibody is Catalog # AAP44197 (Previous Catalog # AAPP11973) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NAT2 |
| Uniprot ID |
P11245 |
| Protein Name |
Arylamine N-acetyltransferase 2 |
| Publications |
Population variability of rhesus macaque (Macaca mulatta) NAT1 gene for arylamine N-acetyltransferase 1: Functional effects and comparison with human. Sci Rep. 9, 10937 (2019). 31358821 |
| Protein Accession # |
NP_000006 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000015 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NAT2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-NAT2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate |
| | Image 2 | |
|
