| Product Number |
ARP44195_T100 |
| Product Page |
www.avivasysbio.com/nat2-antibody-middle-region-arp44195-t100.html |
| Name |
NAT2 Antibody - middle region (ARP44195_T100) |
| Protein Size (# AA) |
290 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
10 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
N-acetyltransferase 2 (arylamine N-acetyltransferase) |
| Alias Symbols |
AAC2, PNAT, NAT-2 |
| Peptide Sequence |
Synthetic peptide located within the following region: CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tamer,L., (2006) Cell Biochem. Funct. 24 (2), 131-135 |
| Description of Target |
NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.This gene encodes N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near NAT2. |
| Protein Interactions |
APP; NAA10; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NAT2 (ARP44195_T100) antibody |
| Specificity |
Antibody reacts with both NAT1 and NAT2 |
| Blocking Peptide |
For anti-NAT2 (ARP44195_T100) antibody is Catalog # AAP44195 (Previous Catalog # AAPP11971) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NAT2 |
| Uniprot ID |
P11245 |
| Protein Name |
Arylamine N-acetyltransferase 2 |
| Protein Accession # |
NP_000006 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000015 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NAT2 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-NAT2 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
| | Image 2 | |
|
