Product Number |
ARP44167_T100 |
Product Page |
www.avivasysbio.com/slc19a1-antibody-n-terminal-region-arp44167-t100.html |
Name |
SLC19A1 Antibody - N-terminal region (ARP44167_T100) |
Protein Size (# AA) |
591 amino acids |
Molecular Weight |
65 kDa |
NCBI Gene Id |
6573 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Solute carrier family 19 (folate transporter), member 1 |
Alias Symbols |
RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1 |
Peptide Sequence |
Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Payton,S.G., (2005) Biochim. Biophys. Acta 1731 (2), 115-124 |
Description of Target |
Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM]. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-SLC19A1 (ARP44167_T100) antibody |
Blocking Peptide |
For anti-SLC19A1 (ARP44167_T100) antibody is Catalog # AAP44167 (Previous Catalog # AAPP11943) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1 |
Uniprot ID |
P41440 |
Protein Name |
Folate transporter 1 |
Publications |
Halwachs, S., Lakoma, C., Schäfer, I., Seibel, P. & Honscha, W. The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier. Mol. Pharmacol. 80, 621-9 (2011). 21737571
Marchi, E. et al. Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies. Clin. Cancer Res. 16, 3648-58 (2010). 20501616 |
Sample Type Confirmation |
SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_919231 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_194255 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC19A1 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution is 1-3 ug/mL for this antibody. |
|