SLC19A1 Antibody - N-terminal region (ARP44167_T100)

Data Sheet
 
Product Number ARP44167_T100
Product Page www.avivasysbio.com/slc19a1-antibody-n-terminal-region-arp44167-t100.html
Name SLC19A1 Antibody - N-terminal region (ARP44167_T100)
Protein Size (# AA) 591 amino acids
Molecular Weight 65 kDa
NCBI Gene Id 6573
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Solute carrier family 19 (folate transporter), member 1
Alias Symbols RFC, CHMD, FOLT, IFC1, REFC, RFC1, hRFC, IFC-1, MEGAF, RFT-1, hSLC19A1
Peptide Sequence Synthetic peptide located within the following region: MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Payton,S.G., (2005) Biochim. Biophys. Acta 1731 (2), 115-124
Description of Target Transport of folate compounds into mammalian cells can occur via receptor-mediated or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. SLC19A1 plays a role in maintaining intracellular concentrations of folate.Transport of folate compounds into mammalian cells can occur via receptor-mediated (see MIM 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (MTX) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. RFC1 plays a role in maintaining intracellular concentrations of folate.[supplied by OMIM].
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-SLC19A1 (ARP44167_T100) antibody
Blocking Peptide For anti-SLC19A1 (ARP44167_T100) antibody is Catalog # AAP44167 (Previous Catalog # AAPP11943)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC19A1
Uniprot ID P41440
Protein Name Folate transporter 1
Publications

Halwachs, S., Lakoma, C., Schäfer, I., Seibel, P. & Honscha, W. The antiepileptic drugs phenobarbital and carbamazepine reduce transport of methotrexate in rat choroid plexus by down-regulation of the reduced folate carrier. Mol. Pharmacol. 80, 621-9 (2011). 21737571

Marchi, E. et al. Pralatrexate is synergistic with the proteasome inhibitor bortezomib in in vitro and in vivo models of T-cell lymphoid malignancies. Clin. Cancer Res. 16, 3648-58 (2010). 20501616

Sample Type Confirmation

SLC19A1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_919231
Purification Protein A purified
Nucleotide Accession # NM_194255
Tested Species Reactivity Human
Gene Symbol SLC19A1
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human kidney
Human kidney
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Recommended dilution is 1-3 ug/mL for this antibody.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com