SLC36A3 antibody - N-terminal region (ARP44155_T100)
Data Sheet
Product Number ARP44155_T100
Product Page
Product Name SLC36A3 antibody - N-terminal region (ARP44155_T100)
Size 100 ul
Gene Symbol SLC36A3
Alias Symbols PAT3, TRAMD2, tramdorin2
Protein Size (# AA) 470 amino acids
Molecular Weight 52kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 285641
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Solute carrier family 36 (proton/amino acid symporter), member 3
Description This is a rabbit polyclonal antibody against SLC36A3. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH
Target Reference Boll,M., (2003) Genomics 82 (1), 47-56
Description of Target The function remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SLC36A3 (ARP44155_T100) antibody is Catalog # AAP44155 (Previous Catalog # AAPP11931)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC36A3
Complete computational species homology data Anti-SLC36A3 (ARP44155_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC36A3.
Swissprot Id Q7Z6B4
Protein Name Proton-coupled amino acid transporter 3
Protein Accession # NP_861439
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC36A3.
Nucleotide Accession # NM_181774
Conjugation Options

ARP44155_T100-FITC Conjugated

ARP44155_T100-HRP Conjugated

ARP44155_T100-Biotin Conjugated

Species Reactivity Human, Pig
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Pig: 80%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-SLC36A3 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 |