| Product Number |
ARP44149_P050 |
| Product Page |
www.avivasysbio.com/slc41a1-antibody-n-terminal-region-arp44149-p050.html |
| Name |
SLC41A1 Antibody - N-terminal region (ARP44149_P050) |
| Protein Size (# AA) |
513 amino acids |
| Molecular Weight |
55kDa |
| NCBI Gene Id |
254428 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 41, member 1 |
| Alias Symbols |
MgtE |
| Peptide Sequence |
Synthetic peptide located within the following region: TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kolisek,M., (2008) J. Biol. Chem. 283 (23), 16235-16247 |
| Description of Target |
SLC41A1 belongs to the SLC41A transporter family. It acts as a magnesium transporter that is responsive to magnesium balance. |
| Protein Interactions |
ELAVL1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC41A1 (ARP44149_P050) antibody |
| Blocking Peptide |
For anti-SLC41A1 (ARP44149_P050) antibody is Catalog # AAP44149 (Previous Catalog # AAPP25593) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC41A1 |
| Uniprot ID |
Q8IVJ1 |
| Protein Name |
Solute carrier family 41 member 1 |
| Protein Accession # |
NP_776253 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173854 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC41A1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IP |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human Fetal Heart, Human Brain
 | Host: Rabbit
Target: SLC41A1
Positive control (+): Human Fetal Heart (HE)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml |
|
| Image 2 | HEK293 Whole Cell Lysate
 | SLC41A1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP44149_P050 with 1:200 dilution. Western blot was performed using ARP44149_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: SLC41A1 IP with ARP44149_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate. |
|
| Image 3 | Human Fetal Liver
 | Host: Rabbit
Target Name: SLC41A1
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
