SLC43A2 Antibody - N-terminal region (ARP44116_P050)

Data Sheet
 
Product Number ARP44116_P050
Product Page www.avivasysbio.com/slc43a2-antibody-n-terminal-region-arp44116-p050.html
Name SLC43A2 Antibody - N-terminal region (ARP44116_P050)
Protein Size (# AA) 489 amino acids
Molecular Weight 53kDa
Subunit 4
NCBI Gene Id 124935
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier family 43, member 2
Alias Symbols LAT4
Peptide Sequence Synthetic peptide located within the following region: TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.
Protein Interactions KRTAP10-3; UBC; ELAVL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC43A2 (ARP44116_P050) antibody
Blocking Peptide For anti-SLC43A2 (ARP44116_P050) antibody is Catalog # AAP44116 (Previous Catalog # AAPP25562)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC43A2
Uniprot ID Q8N370-2
Protein Name Large neutral amino acids transporter small subunit 4
Protein Accession # AAH71859
Purification Affinity Purified
Nucleotide Accession # NM_152346
Tested Species Reactivity Human
Gene Symbol SLC43A2
Predicted Species Reactivity Human, Rat, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 93%; Horse: 85%; Human: 100%; Pig: 86%; Rat: 86%
Image 1
Human Jurkat
WB Suggested Anti-SLC43A2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com