Product Number |
ARP44116_P050 |
Product Page |
www.avivasysbio.com/slc43a2-antibody-n-terminal-region-arp44116-p050.html |
Name |
SLC43A2 Antibody - N-terminal region (ARP44116_P050) |
Protein Size (# AA) |
489 amino acids |
Molecular Weight |
53kDa |
Subunit |
4 |
NCBI Gene Id |
124935 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier family 43, member 2 |
Alias Symbols |
LAT4 |
Peptide Sequence |
Synthetic peptide located within the following region: TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids. |
Protein Interactions |
KRTAP10-3; UBC; ELAVL1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC43A2 (ARP44116_P050) antibody |
Blocking Peptide |
For anti-SLC43A2 (ARP44116_P050) antibody is Catalog # AAP44116 (Previous Catalog # AAPP25562) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC43A2 |
Uniprot ID |
Q8N370-2 |
Protein Name |
Large neutral amino acids transporter small subunit 4 |
Protein Accession # |
AAH71859 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152346 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC43A2 |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Horse: 85%; Human: 100%; Pig: 86%; Rat: 86% |
Image 1 | Human Jurkat
| WB Suggested Anti-SLC43A2 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|