Product Number |
ARP44074_P050 |
Product Page |
www.avivasysbio.com/slc8a3-antibody-n-terminal-region-arp44074-p050.html |
Name |
SLC8A3 Antibody - N-terminal region (ARP44074_P050) |
Protein Size (# AA) |
925 amino acids |
Molecular Weight |
103kDa |
NCBI Gene Id |
6547 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Solute carrier family 8 (sodium/calcium exchanger), member 3 |
Alias Symbols |
NCX3 |
Peptide Sequence |
Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Pulina,M.V., (2006) J. Biol. Chem. 281 (28), 19645-19654 |
Description of Target |
SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described. |
Protein Interactions |
YWHAE; YWHAB; YWHAQ; PPP3CB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SLC8A3 (ARP44074_P050) antibody |
Blocking Peptide |
For anti-SLC8A3 (ARP44074_P050) antibody is Catalog # AAP44074 (Previous Catalog # AAPP25520) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC8A3 |
Uniprot ID |
Q96QG2 |
Protein Name |
Sodium/calcium exchanger 3 |
Publications |
Heise, N. et al. Effect of dexamethasone on Na+/Ca2+ exchanger in dendritic cells. Am. J. Physiol. Cell Physiol. 300, C1306-13 (2011). 21307349 |
Protein Accession # |
NP_150287 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_033262 |
Tested Species Reactivity |
Human |
Gene Symbol |
SLC8A3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human 721_B
| WB Suggested Anti-SLC8A3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 721_B cell lysate |
|