SLC8A3 Antibody - N-terminal region (ARP44074_P050)

Data Sheet
 
Product Number ARP44074_P050
Product Page www.avivasysbio.com/slc8a3-antibody-n-terminal-region-arp44074-p050.html
Name SLC8A3 Antibody - N-terminal region (ARP44074_P050)
Protein Size (# AA) 925 amino acids
Molecular Weight 103kDa
NCBI Gene Id 6547
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Solute carrier family 8 (sodium/calcium exchanger), member 3
Alias Symbols NCX3
Peptide Sequence Synthetic peptide located within the following region: SAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFIIIGICVYVIPDGE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pulina,M.V., (2006) J. Biol. Chem. 281 (28), 19645-19654
Description of Target SLC8A3 is a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner.This gene encodes a member of the sodium/calcium exchanger integral membrane protein family. Three mammalian isoforms in family 8 have been identified. Na+/Ca2+ exchange proteins are involved in maintaining Ca2+ homeostasis in a wide variety of cell types. The protein is regulated by intracellular calcium ions and is found in both the plasma membrane and intracellular organellar membranes, where exchange of Na+ for Ca2+ occurs in an electrogenic manner. Alternative splicing has been observed for this gene and multiple variants have been described.
Protein Interactions YWHAE; YWHAB; YWHAQ; PPP3CB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC8A3 (ARP44074_P050) antibody
Blocking Peptide For anti-SLC8A3 (ARP44074_P050) antibody is Catalog # AAP44074 (Previous Catalog # AAPP25520)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC8A3
Uniprot ID Q96QG2
Protein Name Sodium/calcium exchanger 3
Publications

Heise, N. et al. Effect of dexamethasone on Na+/Ca2+ exchanger in dendritic cells. Am. J. Physiol. Cell Physiol. 300, C1306-13 (2011). 21307349

Protein Accession # NP_150287
Purification Affinity Purified
Nucleotide Accession # NM_033262
Tested Species Reactivity Human
Gene Symbol SLC8A3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human 721_B
WB Suggested Anti-SLC8A3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com