SLC25A32 Antibody - N-terminal region (ARP44049_P050)

• Product Number: ARP44049_P050
• Name: SLC25A32 Antibody - N-terminal region (ARP44049_P050)
• Protein Size (# AA): 315 amino acids
• Molecular Weight: 35 kDa
• NCBI Gene Id: 81034
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 25 (mitochondrial folate carrier) , member 32
• Alias Symbols: MFT, GLYB, MFTC, RREI
• Peptide Sequence: Synthetic peptide located within the following region: VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Titus,S.A. (2000) J. Biol. Chem. 275 (47), 36811-36817
• Description of Target: SLC25A32 transports folate across the inner membranes of mitochondria.
• Protein Interactions: HNRNPU; ELAVL1; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SLC25A32 (ARP44049_P050) antibody is Catalog # AAP44049 (Previous Catalog # AAPP11790)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A32
• Uniprot ID: Q9H2D1
• Protein Name: Mitochondrial folate transporter/carrier
• Protein Accession #: NP_110407
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030780
• Tested Species Reactivity: Human
• Gene Symbol: SLC25A32
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: SLC25A32
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: SLC25A32
  Sample Tissue: Human 786-0 Whole Cell
  Antibody Dilution: 1ug/ml