| Product Number |
ARP44042_P050 |
| Product Page |
www.avivasysbio.com/slc24a6-antibody-middle-region-arp44042-p050.html |
| Name |
SLC24A6 Antibody - middle region (ARP44042_P050) |
| Protein Size (# AA) |
584 amino acids |
| Molecular Weight |
64 kDa |
| NCBI Gene Id |
80024 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 24 (sodium/lithium/calcium exchanger), member 6 |
| Description |
|
| Alias Symbols |
NCLX, NCKX6, SLC24A6 |
| Peptide Sequence |
Synthetic peptide located within the following region: SIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGLGCLLQISRSHTE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Palty,R., (2004) J. Biol. Chem. 279 (24), 25234-25240 |
| Description of Target |
SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).[supplied by OMIM]. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-SLC8B1 (ARP44042_P050) antibody |
| Blocking Peptide |
For anti-SLC8B1 (ARP44042_P050) antibody is Catalog # AAP44042 (Previous Catalog # AAPP11783) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC24A6 |
| Uniprot ID |
Q6J4K2 |
| Protein Name |
Sodium/potassium/calcium exchanger 6 |
| Publications |
Na+ controls hypoxic signalling by the mitochondrial respiratory chain. Nature. 586, 287-291 (2020) 32728214 |
| Protein Accession # |
NP_079235 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024959 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC8B1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-SLC24A6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate |
|
| Image 2 | Human 786-0 Whole Cell
 | Host: Rabbit
Target Name: SLC24A6
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 5ug/ml |
|
| Image 3 |
 | Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|
