| Product Number |
ARP43931_T100 |
| Product Page |
www.avivasysbio.com/slc39a6-antibody-middle-region-arp43931-t100.html |
| Name |
SLC39A6 Antibody - middle region (ARP43931_T100) |
| Protein Size (# AA) |
755 amino acids |
| Molecular Weight |
85 kDa |
| NCBI Gene Id |
25800 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 39 (zinc transporter), member 6 |
| Alias Symbols |
ZIP6, LIV-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A6 belongs to a subfamily of proteins that show structural characteristics of zinc transporters. |
| Protein Interactions |
SUMO1; UBC; NEDD8; SPP1; KDM5B; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-SLC39A6 (ARP43931_T100) antibody |
| Blocking Peptide |
For anti-SLC39A6 (ARP43931_T100) antibody is Catalog # AAP43931 (Previous Catalog # AAPP25466) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC39A6 |
| Uniprot ID |
Q13433-2 |
| Protein Name |
Zinc transporter ZIP6 |
| Publications |
Trokovic, N. et al. Exosomal secretion of death bullets: a new way of apoptotic escape? Am. J. Physiol. Endocrinol. Metab. 303, E1015-24 (2012). 22912365 |
| Sample Type Confirmation |
SLC39A6 is strongly supported by BioGPS gene expression data to be expressed in 721_B, HEK293T, MCF7 |
| Protein Accession # |
NP_001092876 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001099406 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC39A6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 |
 | 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 85 kDa and 49 kDa and the protein may be modified by phosphorylation and/or glycosylation. The canonical 85 kDa isoform was undetectable in these samples. |
|
