SLCO2B1 Antibody - N-terminal region (ARP43926_P050)

• Product Number: ARP43926_P050
• Name: SLCO2B1 Antibody - N-terminal region (ARP43926_P050)
• Protein Size (# AA): 709 amino acids
• Molecular Weight: 77kDa
• NCBI Gene Id: 11309
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier organic anion transporter family, member 2B1
• Alias Symbols: OATPB, OATP-B, OATP2B1, SLC21A9
• Peptide Sequence: Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Miura,M., (2007) Eur. J. Clin. Pharmacol. 63 (12), 1161-1169
• Description of Target: SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
• Protein Interactions: APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLCO2B1 (ARP43926_P050) antibody is Catalog # AAP43926 (Previous Catalog # AAPP25461)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO2B1
• Uniprot ID: O94956
• Protein Name: Solute carrier organic anion transporter family member 2B1
• Sample Type Confirmation:

  SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_009187
• Purification: Affinity Purified
• Nucleotide Accession #: NM_007256
• Tested Species Reactivity: Human
• Gene Symbol: SLCO2B1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Lung Tissue
  
  Rabbit Anti-SLCO2B1 Antibody
  Catalog Number: ARP43926_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Membrane in alveolar type I cells
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
  
• Image 2: HepG2, 293T
  
  Host: Rabbit
  Target: SLCO2B1
  Positive control (+): HepG2 (HG)
  Negative control (-): 293T (2T)
  Antibody concentration: 3ug/ml
• Image 3: Human Hela Whole Cell
  
  Host: Rabbit
  Target Name: SLCO2B1
  Sample Tissue: Human Hela Whole Cell
  Antibody Dilution: 1ug/ml
• Image 4: Human HepG2
  
  WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysateSLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
• Image 5: Human Fetal Lung
  
  Host: Rabbit
  Target Name: SLCO2B1
  Sample Type: Human Fetal Lung
  Antibody Dilution: 1.0ug/ml
• Image 6: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SLCO2B1
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml