SLC22A2 Antibody - N-terminal region (ARP43847_T100)

• Product Number: ARP43847_T100
• Name: SLC22A2 Antibody - N-terminal region (ARP43847_T100)
• Protein Size (# AA): 555 amino acids
• Molecular Weight: 63 kDa
• NCBI Gene Id: 6582
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Solute carrier family 22 (organic cation transporter), member 2
• Alias Symbols: OCT2
• Peptide Sequence: Synthetic peptide located within the following region: MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pelis,R.M., Am. J. Physiol. Renal Physiol. 290 (5), F1118-F1126 (2006)
• Description of Target: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: AGO3; CST9L; LSM4; HYAL3; SUMO2; GTF2B; EXT2; ETV5; POU2AF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-SLC22A2 (ARP43847_T100) antibody is Catalog # AAP43847 (Previous Catalog # AAPS14308)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A2
• Uniprot ID: O15244
• Protein Name: Solute carrier family 22 member 2
• Protein Accession #: NP_003049
• Purification: Protein A purified
• Nucleotide Accession #: NM_003058
• Tested Species Reactivity: Human
• Gene Symbol: SLC22A2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 83%; Dog: 83%; Guinea Pig: 83%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 83%; Rat: 85%
• Image 1: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.