| Product Number |
ARP43842_P050 |
| Product Page |
www.avivasysbio.com/slc16a1-antibody-middle-region-arp43842-p050.html |
| Name |
SLC16A1 Antibody - middle region (ARP43842_P050) |
| Protein Size (# AA) |
500 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
6566 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
| Alias Symbols |
MCT, HHF7, MCT1, MCT1D |
| Peptide Sequence |
Synthetic peptide located within the following region: EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Metz,L., (2008) J. Appl. Physiol. 104 (3), 633-638 |
| Description of Target |
SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the actio |
| Protein Interactions |
UBC; LGR4; BSG; CYSTM1; CUL2; CUL3; MME; SERINC3; DEGS1; AP1S1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC16A1 (ARP43842_P050) antibody |
| Blocking Peptide |
For anti-SLC16A1 (ARP43842_P050) antibody is Catalog # AAP43842 (Previous Catalog # AAPS14303) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC16A1 |
| Uniprot ID |
P53985 |
| Protein Name |
Monocarboxylate transporter 1 |
| Sample Type Confirmation |
SLC16A1 is strongly supported by BioGPS gene expression data to be expressed in HT1080 |
| Protein Accession # |
NP_003042 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003051 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC16A1 |
| Predicted Species Reactivity |
Human |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HT1080
 | WB Suggested Anti-SLC16A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysateSLC16A1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells |
| | Image 2 | Human Bronchial Epithelial Tissue
 | Rabbit Anti-SLC16A1 Antibody
Catalog Number: ARP43842_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Membrane and cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
|
