| Product Number |
ARP43834_P050 |
| Product Page |
www.avivasysbio.com/slc6a1-antibody-middle-region-arp43834-p050.html |
| Name |
SLC6A1 Antibody - middle region (ARP43834_P050) |
| Protein Size (# AA) |
599 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
6529 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 6 (neurotransmitter transporter, GABA), member 1 |
| Alias Symbols |
MAE, GAT1, GABATR, GABATHG |
| Peptide Sequence |
Synthetic peptide located within the following region: CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gotlib,I.H., (2008) Biol. Psychiatry 63 (9), 847-851 |
| Description of Target |
SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine. |
| Protein Interactions |
Htt; STX1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC6A1 (ARP43834_P050) antibody |
| Blocking Peptide |
For anti-SLC6A1 (ARP43834_P050) antibody is Catalog # AAP43834 (Previous Catalog # AAPP26614) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC6A1 |
| Uniprot ID |
P30531 |
| Protein Name |
Sodium- and chloride-dependent GABA transporter 1 |
| Protein Accession # |
NP_003033 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003042 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
SLC6A1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 93% |
| Image 1 | mouse brain
 | mouse brain |
| | Image 2 | Human Liver
 | WB Suggested Anti-SLC6A1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver |
|
|
