SLC37A4 Antibody - middle region (ARP43821_P050)

• Product Number: ARP43821_P050
• Name: SLC37A4 Antibody - middle region (ARP43821_P050)
• Protein Size (# AA): 429 amino acids
• Molecular Weight: 46 kDa
• NCBI Gene Id: 2542
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Solute carrier family 37 (glucose-6-phosphate transporter), member 4
• Alias Symbols: G6PT1, G6PT2, G6PT3, GSD1b, GSD1c, GSD1d, TRG19, TRG-19, PRO0685
• Peptide Sequence: Synthetic peptide located within the following region: VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Fortier,S., (2008) FEBS Lett. 582 (5), 799-804
• Description of Target: SLC37A4 transports glucose-6-phosphate from the cytoplasm to the lumen of the endoplasmic reticulum. It forms with glucose-6-phosphatase the complex responsible for glucose production through glycogenolysis and gluconeogenesis. Hence, it plays a central role in homeostatic regulation of blood glucose levels.
• Protein Interactions: SHBG; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-SLC37A4 (ARP43821_P050) antibody is Catalog # AAP43821 (Previous Catalog # AAPS14106)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC37A4
• Uniprot ID: O43826
• Protein Name: Glucose-6-phosphate translocase
• Sample Type Confirmation:

  SLC37A4 is supported by BioGPS gene expression data to be expressed in OVCAR3

• Protein Accession #: NP_001458
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001467
• Tested Species Reactivity: Human
• Gene Symbol: SLC37A4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 93%
• Image 1: Human OVCAR-3
  
  WB Suggested Anti-SLC37A4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: OVCAR-3 cell lysateSLC37A4 is supported by BioGPS gene expression data to be expressed in OVCAR3
• Image 2: Human Adult Liver
  
  Rabbit Anti-SLC37A4 Antibody
  Catalog Number: ARP43821_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
  Observed Staining: Cytoplasm in hepatocytes, weak signal, low tissue distribution
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 – 2.0 sec
  Protocol located in Reviews and Data.
• Image 3: Human Fetal Kidney
  
  Host: Rabbit
  Target Name: SLC37A4
  Sample Type: Human Fetal Kidney
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Fetal Liver
  
  Host: Rabbit
  Target Name: SLC37A4
  Sample Type: Human Fetal Liver
  Antibody Dilution: 1.0ug/ml