SLC25A4 Antibody - N-terminal region (ARP43818_P050)

Data Sheet
 
Product Number ARP43818_P050
Product Page www.avivasysbio.com/slc25a4-antibody-n-terminal-region-arp43818-p050.html
Name SLC25A4 Antibody - N-terminal region (ARP43818_P050)
Gene Symbol SLC25A4
Alias Symbols ANT, ANT1, PEO2, PEO3, T1, AAC1
Protein Size (# AA) 298 amino acids
Molecular Weight 33kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 291
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
Peptide Sequence Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Description of Target This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
Protein Interactions UBC; MDM2; PARK2; CLN5; CLN3; UBL4A; RPLP0P6; RPL10L; UQCRFS1P1; UQCRC1; RPS3A; RPS2; RPSA; GALNT2; UBD; COPS5; CDK2; TCF3; SUMO4; ICT1; NFKBIA; MGMT; PPID; PPIF; BAX; AR; PRKCE; NR3C1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SLC25A4 (ARP43818_P050) antibody
Blocking Peptide For anti-SLC25A4 (ARP43818_P050) antibody is Catalog # AAP43818 (Previous Catalog # AAPS14103)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A4
Complete computational species homology data Anti-SLC25A4 (ARP43818_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC25A4.
Swissprot Id Q05962
Protein Name ADP/ATP translocase 1
Sample Type Confirmation

SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226

Protein Accession # NP_001142
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC25A4.
Nucleotide Accession # NM_001151
Replacement Item This antibody may replace item sc-11433 from Santa Cruz Biotechnology.
Tested Species Reactivity Human, Rat
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Image 1
Rat Skeletal Muscle
Host: Rabbit
Target Name: SLC25A4
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 2
Rat Skeletal Muscle
Host: Rat
Target Name: SLC25A4
Sample Tissue: Rat Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 3
Human Pineal Tissue
Rabbit Anti-SLC25A4 Antibody
Catalog Number: ARP43818_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 4
Human A549 Whole Cell
Host: Rabbit
Target Name: SLC25A4
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml
Image 5
MCF7, A549
Host: Rabbit
Target: SLC25A4
Positive control (+): MCF7 (N10)
Negative control (-): A549 (N03)
Antibody concentration: 1ug/ml
Image 6
Human DLD1 Whole Cell
Host: Rabbit
Target Name: SLC25A4
Sample Tissue: Human DLD1 Whole Cell
Antibody Dilution: 1ug/ml
Image 7
Human Ovary Tumor
Host: Rabbit
Target Name: SLC25A4
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml
Image 8
Human RPMI-8226
Host: Rabbit
Target Name: SLC25A4
Sample Tissue: Human RPMI-8226
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com