SLC2A9 Antibody - middle region : HRP (ARP43757_P050-HRP)

Data Sheet
 
Product Number ARP43757_P050-HRP
Product Page www.avivasysbio.com/slc2a9-antibody-middle-region-hrp-arp43757-p050-hrp.html
Name SLC2A9 Antibody - middle region : HRP (ARP43757_P050-HRP)
Gene Symbol SLC2A9
Alias Symbols GLUT9, GLUTX, UAQTL2, URATv1
Protein Size (# AA) 511 amino acids
Molecular Weight 56kDa
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Conjugation HRP
NCBI Gene Id 56606
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Official Gene Full Name Solute carrier family 2 (facilitated glucose transporter), member 9
Peptide Sequence Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Target Reference Brandstatter,A., (er) Diabetes Care (2008) In press
Description of Target SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-SLC2A9 (ARP43757_P050-HRP) antibody
Blocking Peptide For anti-SLC2A9 (ARP43757_P050-HRP) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC2A9
Complete computational species homology data Anti-SLC2A9 (ARP43757_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SLC2A9.
Swissprot Id Q9NRM0
Protein Name Solute carrier family 2, facilitated glucose transporter member 9
Publications

Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). WB, Human, Horse, Guinea pig, Mouse, Bovine, Dog, Rat, Rabbit 24006279

Sample Type Confirmation

SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001001290
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SLC2A9.
Nucleotide Accession # NM_001001290
Replacement Item This antibody may replace item sc-105399 from Santa Cruz Biotechnology.
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79%
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com