| Product Number |
ARP43757_P050-FITC |
| Product Page |
www.avivasysbio.com/slc2a9-antibody-middle-region-fitc-arp43757-p050-fitc.html |
| Name |
SLC2A9 Antibody - middle region : FITC (ARP43757_P050-FITC) |
| Protein Size (# AA) |
511 amino acids |
| Molecular Weight |
56kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
56606 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 2 (facilitated glucose transporter), member 9 |
| Alias Symbols |
GLUT9, GLUTX, UAQTL2, URATv1 |
| Peptide Sequence |
Synthetic peptide located within the following region: VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Brandstatter,A., (er) Diabetes Care (2008) In press |
| Description of Target |
SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC2A9 (ARP43757_P050-FITC) antibody |
| Blocking Peptide |
For anti-SLC2A9 (ARP43757_P050-FITC) antibody is Catalog # AAP43757 (Previous Catalog # AAPP25347) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SLC2A9 |
| Uniprot ID |
Q9NRM0 |
| Protein Name |
Solute carrier family 2, facilitated glucose transporter member 9 |
| Publications |
Gaccioli, F. et al. Maternal overweight induced by a diet with high content of saturated fat activates placental mTOR and eIF2 alpha signaling and increases fetal growth in rats. Biol. Reprod. 89, 96 (2013). WB, Human, Horse, Guinea pig, Mouse, Bovine, Dog, Rat, Rabbit 24006279 |
| Sample Type Confirmation |
SLC2A9 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_001001290 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001001290 |
| Gene Symbol |
SLC2A9 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 79% |
| Image 1 | |
