| Product Number |
ARP43751_P050 |
| Product Page |
www.avivasysbio.com/slc5a5-antibody-n-terminal-region-arp43751-p050.html |
| Name |
SLC5A5 Antibody - N-terminal region (ARP43751_P050) |
| Protein Size (# AA) |
643 amino acids |
| Molecular Weight |
69 kDa |
| NCBI Gene Id |
6528 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Solute carrier family 5 (sodium iodide symporter), member 5 |
| Alias Symbols |
NIS, TDH1 |
| Peptide Sequence |
Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The sodium-iodide symporter (NIS, or SLC5A5) is a key plasma membrane protein that mediates active I- uptake in thyroid, lactating breast, and other tissues with an electrogenic stoichiometry of 2 Na+ per I-. In thyroid, NIS-mediated I- uptake is the first step in the biosynthesis of iodine-containing thyroid hormones. |
| Protein Interactions |
ERBB2IP; SLC5A5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-SLC5A5 (ARP43751_P050) antibody |
| Blocking Peptide |
For anti-SLC5A5 (ARP43751_P050) antibody is Catalog # AAP43751 (Previous Catalog # AAPP25341) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC5A5 |
| Uniprot ID |
Q92911 |
| Protein Name |
Sodium/iodide cotransporter |
| Protein Accession # |
NP_000444 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000453 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC5A5 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Horse |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100%; Mouse: 79%; Rat: 93% |
| Image 1 | liver
 | Rabbit Anti-SLC5A5 Antibody
Catalog Number: ARP43751_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult liver
Observed Staining: Membrane
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
| | Image 2 | Human liver
 | WB Suggested Anti-SLC5A5 antibody Titration: 1 ug/mL
Sample Type: Human liver |
| | Image 3 |
 | 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
|
