ABCG5 Antibody - middle region (ARP43703_P050)

• Product Number: ARP43703_P050
• Name: ABCG5 Antibody - middle region (ARP43703_P050)
• Protein Size (# AA): 651 amino acids
• Molecular Weight: 73 kDa
• NCBI Gene Id: 64240
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ATP-binding cassette, sub-family G (WHITE), member 5
• Alias Symbols: STSL, STSL2
• Peptide Sequence: Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia.
• Protein Interactions: Dlg4; ABCG8;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-ABCG5 (ARP43703_P050) antibody is Catalog # AAP43703 (Previous Catalog # AAPP11692)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ABCG5
• Uniprot ID: Q9H222
• Protein Name: ATP-binding cassette sub-family G member 5
• Protein Accession #: NP_071881
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022436
• Tested Species Reactivity: Human
• Gene Symbol: ABCG5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
• Image 1: Human Spleen
  
  WB Suggested Anti-ABCG5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Spleen