| Product Number |
ARP43690_P050-Biotin |
| Product Page |
www.avivasysbio.com/abca7-antibody-middle-region-biotin-arp43690-p050-biotin.html |
| Name |
Abca7 Antibody - middle region : Biotin (ARP43690_P050-Biotin) |
| Protein Size (# AA) |
2159 amino acids |
| Molecular Weight |
237kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
27403 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATP-binding cassette, sub-family A (ABC1), member 7 |
| Alias Symbols |
ABCX, Abc5, Abc51 |
| Peptide Sequence |
Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation. |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-Abca7 (ARP43690_P050-Biotin) antibody |
| Blocking Peptide |
For anti-Abca7 (ARP43690_P050-Biotin) antibody is Catalog # AAP43690 (Previous Catalog # AAPP11679) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q91V24 |
| Protein Name |
ATP-binding cassette sub-family A member 7 |
| Protein Accession # |
NP_038878 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013850 |
| Gene Symbol |
Abca7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100% |
| Image 1 | |
|
