| Product Number |
ARP43690_P050 |
| Product Page |
www.avivasysbio.com/abca7-antibody-middle-region-arp43690-p050.html |
| Name |
Abca7 Antibody - middle region (ARP43690_P050) |
| Protein Size (# AA) |
2159 amino acids |
| Molecular Weight |
237kDa |
| NCBI Gene Id |
27403 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATP-binding cassette, sub-family A (ABC1), member 7 |
| Alias Symbols |
ABCX, Abc5, Abc51 |
| Peptide Sequence |
Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Abca7 plays a role in phagocytosis by macrophages of apoptotic cells.Abca7 binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells. Abca7 may also mediate cholesterol efflux. Abca7 may regulate cellular ceramide homeostasis during keratinocytes differentiation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Abca7 (ARP43690_P050) antibody |
| Blocking Peptide |
For anti-Abca7 (ARP43690_P050) antibody is Catalog # AAP43690 (Previous Catalog # AAPP11679) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q91V24 |
| Protein Name |
ATP-binding cassette sub-family A member 7 |
| Publications |
Genetic Variations in ABCA7 Can Increase Secreted Levels of Amyloid-b40 and Amyloid-b42 Peptides and ABCA7 Transcription in Cell Culture Models. J. Alzheimers Dis. 53, 875-92 (2016). 27314524 |
| Protein Accession # |
NP_038878 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013850 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Abca7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rat: 100% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Abca7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Liver |
|
| Image 2 | Mouse Spleen
 | Host: Rabbit
Target Name: ABCA7
Sample Tissue: Mouse Spleen
Antibody Dilution: 1ug/ml |
|
| Image 3 | Rodent Mouse Testis
 | Host: Rabbit
Target Name: ABCA7
Sample Tissue: Rodent Mouse Testis
Antibody Dilution: 1ug/ml |
|
