ABCA5 Antibody - C-terminal region (ARP43688_P050)

• Product Number: ARP43688_P050
• Name: ABCA5 Antibody - C-terminal region (ARP43688_P050)
• Protein Size (# AA): 1642 amino acids
• Molecular Weight: 186kDa
• NCBI Gene Id: 23461
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ATP-binding cassette, sub-family A (ABC1), member 5
• Alias Symbols: HTC3, ABC13, EST90625
• Peptide Sequence: Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ohtsuki,S., (2007) Biol. Pharm. Bull. 30 (6), 1144-1146
• Description of Target: The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.
• Protein Interactions: NR4A1; CYP2E1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Human Small Intestine (formalin-fixed, paraffin-embedded) stained with ABCA5 antibody ARP43688_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
  IHC Information: Human Small Intestine (formalin-fixed, paraffin-embedded) stained with ABCA5 antibody ARP43688_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
• Blocking Peptide: For anti-ABCA5 (ARP43688_P050) antibody is Catalog # AAP43688 (Previous Catalog # AAPP11677)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ABCA5
• Uniprot ID: Q8WWZ7
• Protein Name: ATP-binding cassette sub-family A member 5
• Protein Accession #: NP_061142
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018672
• Tested Species Reactivity: Human
• Gene Symbol: ABCA5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%
• Image 1: Human Colon
  
  Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0ug/ml using anti-ABCA5 antibody (ARP43688_P050)
• Image 2: Human MCF-7
  
  WB Suggested Anti-ABCA5 Antibody Titration: 1 ug/ml
  Positive Control: MCF-7 whole cell lysates