ABCC9 Antibody - middle region (ARP43664_P050)

• Product Number: ARP43664_P050
• Name: ABCC9 Antibody - middle region (ARP43664_P050)
• Protein Size (# AA): 1549 amino acids
• Molecular Weight: 174kDa
• NCBI Gene Id: 10060
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 9
• Alias Symbols: SUR2, ABC37, CANTU, CMD1O, ATFB12
• Peptide Sequence: Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Burke,M.A., (2008) Circ. Res. 102 (2), 164-176
• Description of Target: ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle. Protein structure suggests a role as the drug-binding channel-modulating subunit of the extrapancreatic ATP-sensitive potassium channels. No disease has been associated with this gene thus far. Alternative splicing of this gene results in several products, two of which result from differential usage of two terminal exons and one of which results from exon deletion.
• Protein Interactions: EEF1G; KCNJ11; KCNJ8; STX1A; LDHA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ABCC9 (ARP43664_P050) antibody is Catalog # AAP43664 (Previous Catalog # AAPP11653)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ABCC9
• Uniprot ID: O60706
• Protein Name: ATP-binding cassette sub-family C member 9
• Sample Type Confirmation:

  ABCC9 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_005682
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005691
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ABCC9
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Mouse brain
  
  Lanes:
  1: 10ug SUR1 KO mouse ventricle lysate, 2: 10ug WT mouse ventricle lysate, 3: 0.1ug SUR1 overexpressing mouse ventricle lysate, 4: 10ug cannine ventricle lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:2000
  Gene Name:
  ABCC9
  Submitted by:
  Haixia Zhang
  
• Image 2: Human PANC1
  
  Host: Rabbit
  Target Name: ABCC9
  Sample Tissue: Human PANC1
  Antibody Dilution: 1.0ug/ml
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.