| Product Number |
ARP43660_P050 |
| Product Page |
www.avivasysbio.com/abca1-antibody-middle-region-arp43660-p050.html |
| Name |
Abca1 Antibody - middle region (ARP43660_P050) |
| Protein Size (# AA) |
2261 amino acids |
| Molecular Weight |
254kDa |
| NCBI Gene Id |
11303 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ATP-binding cassette, sub-family A (ABC1), member 1 |
| Alias Symbols |
ABC, Abc1, ABC-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Abca1 is a cAMP-dependent and sulfonylurea-sensitive anion transporter. Abca1 is a key gatekeeper influencing intracellular cholesterol transport. |
| Protein Interactions |
Sptlc1; Ubc; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Abca1 (ARP43660_P050) antibody |
| Blocking Peptide |
For anti-Abca1 (ARP43660_P050) antibody is Catalog # AAP43660 (Previous Catalog # AAPP11649) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
B1AWZ8 |
| Protein Name |
ATP-binding cassette sub-family A member 1 |
| Publications |
Fu, Y. et al. ABCA12 Regulates ABCA1-Dependent Cholesterol Efflux from Macrophages and the Development of Atherosclerosis. Cell Metab. 18, 225-38 (2013). 23931754 |
| Protein Accession # |
NP_038482 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_013454 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Abca1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 86% |
| Image 1 | Mouse Kidney
 | WB Suggested Anti-Abca1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Mouse Kidney |
| | Image 2 | Mouse Mouse Liver
 | Host: Rabbit
Target Name: ABCA1
Sample Tissue: Mouse Mouse Liver
Antibody Dilution: 3ug/ml |
|
|
