MTTP Antibody - N-terminal region (ARP43618_P050)

• Product Number: ARP43618_P050
• Name: MTTP Antibody - N-terminal region (ARP43618_P050)
• Protein Size (# AA): 894 amino acids
• Molecular Weight: 99 kDa
• NCBI Gene Id: 4547
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Microsomal triglyceride transfer protein
• Alias Symbols: ABL, MTP
• Peptide Sequence: Synthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lundahl,B., Am. J. Physiol. Endocrinol. Metab. 290 (4), E739-E745 (2006)
• Description of Target: MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.
• Protein Interactions: HSP90B1; APOB;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Blocking Peptide: For anti-MTTP (ARP43618_P050) antibody is Catalog # AAP43618 (Previous Catalog # AAPS15812)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTTP
• Uniprot ID: P55157
• Protein Name: Microsomal triglyceride transfer protein large subunit
• Publications:

  Cardiomyocyte Regulation of Systemic Lipid Metabolism by the Apolipoprotein B-Containing Lipoproteins in Drosophila. PLoS Genet. 13, e1006555 (2017). 28095410

  In Vitro effect of DDE exposure on the regulation of lipid metabolism and secretion in McA-RH7777 hepatocytes: A potential role in dyslipidemia which may increase the risk of type 2 diabetes mellitus. Toxicol In Vitro. 37, 9-14 (2016). 27565303

• Sample Type Confirmation:

  MTTP is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_000244
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000253
• Tested Species Reactivity: Human
• Gene Symbol: MTTP
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2 Whole Cell
  
  Host: Rabbit
  Target Name: MTTP
  Sample Tissue: Human HepG2 Whole Cell
  Antibody Dilution: 3ug/ml
• Image 2: