ADH4 Antibody - middle region (ARP43572_P050)

• Product Number: ARP43572_P050
• Name: ADH4 Antibody - middle region (ARP43572_P050)
• Protein Size (# AA): 380 amino acids
• Molecular Weight: 40kDa
• NCBI Gene Id: 127
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Alcohol dehydrogenase 4 (class II), pi polypeptide
• Alias Symbols: ADH-2, HEL-S-4
• Peptide Sequence: Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kuo,P.H., (2008) Alcohol. Clin. Exp. Res. 32 (5), 785-795
• Description of Target: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; RPL35; YWHAE; APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Fetal liver cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Blocking Peptide: For anti-ADH4 (ARP43572_P050) antibody is Catalog # AAP43572 (Previous Catalog # AAPP25017)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADH4
• Uniprot ID: P08319
• Protein Name: Alcohol dehydrogenase 4
• Publications:

  Retinoid regulation of antiviral innate immunity in hepatocytes. Hepatology. 63, 1783-95 (2016). 26638120

• Protein Accession #: NP_000661
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000670
• Tested Species Reactivity: Human
• Gene Symbol: ADH4
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-ADH4 Antibody Titration: 1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human Fetal liver
  
  Immunohistochemistry with Fetal liver cell lysate tissue at an antibody concentration of 1.25 ug/ml using anti-ADH4 antibody (ARP43572_P050)