| Product Number |
ARP43562_T100 |
| Product Page |
www.avivasysbio.com/gls2-antibody-middle-region-arp43562-t100.html |
| Name |
GLS2 Antibody - middle region (ARP43562_T100) |
| Protein Size (# AA) |
327 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
27165 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Glutaminase 2 (liver, mitochondrial) |
| Alias Symbols |
GA, GLS, LGA, hLGA |
| Peptide Sequence |
Synthetic peptide located within the following region: FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well. |
| Protein Interactions |
SNTA1; GRHPR; TAX1BP3; PAG1; DLG2; INADL; DLG4; RGS3; DLG1; DLG3; CASK; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GLS2 (ARP43562_T100) antibody |
| Blocking Peptide |
For anti-GLS2 (ARP43562_T100) antibody is Catalog # AAP43562 (Previous Catalog # AAPP25007) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GLS2 |
| Uniprot ID |
Q9UI32 |
| Protein Name |
Glutaminase liver isoform, mitochondrial |
| Publications |
Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277
Toriumi, K. et al. Prenatal NMDA receptor antagonism impaired proliferation of neuronal progenitor, leading to fewer glutamatergic neurons in the prefrontal cortex. Neuropsychopharmacology 37, 1387-96 (2012). 22257896 |
| Sample Type Confirmation |
GLS2 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
EAW96942 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_013267 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GLS2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human NCI-H226
 | Host: Rabbit
Target Name: GLS2
Sample Tissue: Human NCI-H226
Antibody Dilution: 1.0ug/ml |
|
