Product Number |
ARP43534_T100 |
Product Page |
www.avivasysbio.com/aadat-antibody-n-terminal-region-arp43534-t100.html |
Name |
AADAT Antibody - N-terminal region (ARP43534_T100) |
Protein Size (# AA) |
425 amino acids |
Molecular Weight |
47 kDa |
NCBI Gene Id |
51166 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Aminoadipate aminotransferase |
Alias Symbols |
KAT2, KATII, KYAT2 |
Peptide Sequence |
Synthetic peptide located within the following region: AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Goh,D.L., (2002) Mol. Genet. Metab. 76 (3), 172-180 |
Description of Target |
AADAT is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties.This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-AADAT (ARP43534_T100) antibody |
Blocking Peptide |
For anti-AADAT (ARP43534_T100) antibody is Catalog # AAP43534 (Previous Catalog # AAPP11526) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AADAT |
Uniprot ID |
Q8N5Z0 |
Protein Name |
Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial |
Protein Accession # |
NP_057312 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_016228 |
Tested Species Reactivity |
Human |
Gene Symbol |
AADAT |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 79%; Rabbit: 100%; Rat: 85%; Zebrafish: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-AADAT Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysate |
|
Image 2 | Human kidney
| Human kidney |
|
Image 3 |
| 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Protein is processed to mature 44 kDa and the protein may be modified by succinyl lysine at several residues. |
|