| Product Number |
ARP43481_P050 |
| Product Page |
www.avivasysbio.com/hectd2-antibody-c-terminal-region-arp43481-p050.html |
| Name |
HECTD2 Antibody - C-terminal region (ARP43481_P050) |
| Protein Size (# AA) |
776 amino acids |
| Molecular Weight |
88kDa |
| NCBI Gene Id |
143279 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
HECT domain containing E3 ubiquitin protein ligase 2 |
| Alias Symbols |
FLJ16050 |
| Peptide Sequence |
Synthetic peptide located within the following region: TDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGGMADLNFKISKNET |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Deloukas,P., (2004) Nature 429 (6990), 375-381 |
| Description of Target |
HECTD2 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. |
| Protein Interactions |
ELAVL1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HECTD2 (ARP43481_P050) antibody |
| Blocking Peptide |
For anti-HECTD2 (ARP43481_P050) antibody is Catalog # AAP43481 (Previous Catalog # AAPY01342) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HECTD2 |
| Uniprot ID |
Q5RD78 |
| Protein Name |
Probable E3 ubiquitin-protein ligase HECTD2 |
| Publications |
Sun, T. et al. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A. Oncogene (2013). doi:10.1038/onc.2013.230 23770851 |
| Protein Accession # |
NP_877497 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182765 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HECTD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 86%; Zebrafish: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-HECTD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
|
