| Product Number |
ARP43418_T100 |
| Product Page |
www.avivasysbio.com/rnf165-antibody-n-terminal-region-arp43418-t100.html |
| Name |
RNF165 Antibody - N-terminal region (ARP43418_T100) |
| Protein Size (# AA) |
346 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
494470 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Ring finger protein 165 |
| Alias Symbols |
ARKL2, Ark2C, RNF111L2 |
| Peptide Sequence |
Synthetic peptide located within the following region: MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder. |
| Protein Interactions |
UBE2W; UBE2D4; UBE2E3; UBE2N; UBE2E1; UBE2D3; UBE2D2; UBE2D1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RNF165 (ARP43418_T100) antibody |
| Blocking Peptide |
For anti-RNF165 (ARP43418_T100) antibody is Catalog # AAP43418 (Previous Catalog # AAPP25201) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RNF165 |
| Uniprot ID |
Q6ZSG1 |
| Protein Name |
RING finger protein 165 |
| Protein Accession # |
NP_689683 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_152470 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RNF165 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RNF165 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
