| Product Number |
ARP43237_P050 |
| Product Page |
www.avivasysbio.com/herc6-antibody-n-terminal-region-arp43237-p050.html |
| Name |
HERC6 Antibody - N-terminal region (ARP43237_P050) |
| Protein Size (# AA) |
1022 amino acids |
| Molecular Weight |
115kDa |
| NCBI Gene Id |
55008 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
HECT and RLD domain containing E3 ubiquitin protein ligase family member 6 |
| Alias Symbols |
FLJ20637 |
| Peptide Sequence |
Synthetic peptide located within the following region: LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]). |
| Protein Interactions |
FUS; UBC; HSP90AA1; UBQLN2; HERC4; HERC3; NME2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-HERC6 (ARP43237_P050) antibody |
| Blocking Peptide |
For anti-HERC6 (ARP43237_P050) antibody is Catalog # AAP43237 (Previous Catalog # AAPP11312) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HERC6 |
| Uniprot ID |
Q8IVU3 |
| Protein Name |
Probable E3 ubiquitin-protein ligase HERC6 |
| Sample Type Confirmation |
HERC6 is supported by BioGPS gene expression data to be expressed in HEK293 |
| Protein Accession # |
NP_060382 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_017912 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HERC6 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human ACHN
 | WB Suggested Anti-HERC6 Antibody Titration: 0.2-1 ug/ml
Positive Control: ACHN cell lysate |
|
