HERC5 Antibody - middle region (ARP43213_P050)

• Product Number: ARP43213_P050
• Name: HERC5 Antibody - middle region (ARP43213_P050)
• Protein Size (# AA): 1024 amino acids
• Molecular Weight: 117kDa
• NCBI Gene Id: 51191
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: HECT and RLD domain containing E3 ubiquitin protein ligase 5
• Alias Symbols: CEB1, CEBP1
• Peptide Sequence: Synthetic peptide located within the following region: FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Salon,C., (2007) Oncogene 26 (48), 6927-6936
• Description of Target: HERC5 is a member of the HERC family of ubiquitin ligases.It contains a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulates expression of HERC5 protein in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets.This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.
• Protein Interactions: UBC; SMAD4; UBE2D1; gag; ISG15; TXNRD1; IRF3; HSPA8; CTNNB1; HERC5; SIRT7; STK38; PITX2; ERCC2; CCND1; CCNE1; CCNB1; CCNA2; NME2; CDKN1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-HERC5 (ARP43213_P050) antibody is Catalog # AAP43213 (Previous Catalog # AAPP25182)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HERC5
• Uniprot ID: Q69G20
• Protein Name: E3 ISG15--protein ligase HERC5
• Sample Type Confirmation:

  HERC5 is supported by BioGPS gene expression data to be expressed in HEK293

• Protein Accession #: NP_057407
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016323
• Tested Species Reactivity: Human
• Gene Symbol: HERC5
• Predicted Species Reactivity: Human, Rat, Cow, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 86%; Rat: 79%
• Image 1: Human HepG2
  
  WB Suggested Anti-HERC5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate
• Image 2: Human Pineal Tissue
  
  Rabbit Anti-HERC5 Antibody
  Catalog Number: ARP43213_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic in cell bodies and processes of pinealocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec