FBXW2 Antibody - middle region (ARP43109_P050)

Data Sheet
 
Product Number ARP43109_P050
Product Page www.avivasysbio.com/fbxw2-antibody-middle-region-arp43109-p050.html
Name FBXW2 Antibody - middle region (ARP43109_P050)
Protein Size (# AA) 454 amino acids
Molecular Weight 51kDa
NCBI Gene Id 26190
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name F-box and WD repeat domain containing 2
Alias Symbols Md6, FBW2, Fwd2
Peptide Sequence Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yang,C.S., (2005) J. Biol. Chem. 280 (11), 10083-10090
Description of Target F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. FBXW2 is the second identified member of the F-box family and contains multiple WD-40 repeats.F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-40 repeats.
Protein Interactions SKP1; FBXO6; CUL1; GNB2L1; GCM1; HSP90AA1; BTG2; BTG1; REST; RBX1; FBXW8; EP300; UBE2D2; CDC34;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for ARP43109_P050
Blocking Peptide Catalog # AAP43109 (Previous Catalog # AAPP25080)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FBXW2
Uniprot ID Q9UKT8
Protein Name F-box/WD repeat-containing protein 2
Publications

Van Rechem, C. et al. The SKP1-Cul1-F-box and leucine-rich repeat protein 4 (SCF-FbxL4) ubiquitin ligase regulates lysine demethylase 4A (KDM4A)/Jumonji domain-containing 2A (JMJD2A) protein. J. Biol. Chem. 286, 30462-70 (2011). 21757720

Sample Type Confirmation

FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_036296
Purification Affinity Purified
Nucleotide Accession # NM_012164
Tested Species Reactivity Human
Gene Symbol FBXW2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Adult Placenta
Host: Rabbit
Target Name: CHAD
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
Image 2
Human Fetal Lung
Host: Rabbit
Target Name: FBXW2
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Liver
Host: Rabbit
Target Name: FBXW2
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 4
Human Fetal Heart
Host: Rabbit
Target Name: FBXW2
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
Image 5
Human Jurkat
WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateFBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat
Image 6
Human Placenta, 293T Cell Lysate
Host: Rabbit
Target: FBXW2
Positive control (+): Human Placenta (PL)
Negative control (-): 293T Cell Lysate (2T)
Antibody concentration: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com