Product Number |
ARP43109_P050 |
Product Page |
www.avivasysbio.com/fbxw2-antibody-middle-region-arp43109-p050.html |
Name |
FBXW2 Antibody - middle region (ARP43109_P050) |
Protein Size (# AA) |
454 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
26190 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
F-box and WD repeat domain containing 2 |
Alias Symbols |
Md6, FBW2, Fwd2 |
Peptide Sequence |
Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yang,C.S., (2005) J. Biol. Chem. 280 (11), 10083-10090 |
Description of Target |
F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. FBXW2 is the second identified member of the F-box family and contains multiple WD-40 repeats.F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-40 repeats. |
Protein Interactions |
SKP1; FBXO6; CUL1; GNB2L1; GCM1; HSP90AA1; BTG2; BTG1; REST; RBX1; FBXW8; EP300; UBE2D2; CDC34; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for ARP43109_P050 |
Blocking Peptide |
Catalog # AAP43109 (Previous Catalog # AAPP25080) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FBXW2 |
Uniprot ID |
Q9UKT8 |
Protein Name |
F-box/WD repeat-containing protein 2 |
Publications |
Van Rechem, C. et al. The SKP1-Cul1-F-box and leucine-rich repeat protein 4 (SCF-FbxL4) ubiquitin ligase regulates lysine demethylase 4A (KDM4A)/Jumonji domain-containing 2A (JMJD2A) protein. J. Biol. Chem. 286, 30462-70 (2011). 21757720 |
Sample Type Confirmation |
FBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_036296 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012164 |
Tested Species Reactivity |
Human |
Gene Symbol |
FBXW2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human Adult Placenta
| Host: Rabbit Target Name: CHAD Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
|
Image 2 | Human Fetal Lung
| Host: Rabbit Target Name: FBXW2 Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human Fetal Liver
| Host: Rabbit Target Name: FBXW2 Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human Fetal Heart
| Host: Rabbit Target Name: FBXW2 Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
|
Image 5 | Human Jurkat
| WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysateFBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
Image 6 | Human Placenta, 293T Cell Lysate
| Host: Rabbit Target: FBXW2 Positive control (+): Human Placenta (PL) Negative control (-): 293T Cell Lysate (2T) Antibody concentration: 1ug/ml |
|