| Product Number |
ARP42856_P050 |
| Product Page |
www.avivasysbio.com/rgs10-antibody-n-terminal-region-arp42856-p050.html |
| Name |
Rgs10 Antibody - N-terminal region (ARP42856_P050) |
| Protein Size (# AA) |
181 amino acids |
| Molecular Weight |
21kDa |
| NCBI Gene Id |
67865 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Regulator of G-protein signalling 10 |
| Alias Symbols |
2310010N19Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Rgs10 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs10 associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity of Rgs10 on G(z)-alpha is inhibited by palmitoylation of the G-protein. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Rgs10 (ARP42856_P050) antibody |
| Other Applications Image 1 Data |
FACS --
Sample type: Bone marrow derived monocytes from mice BV2 cells
Dilution: 1ug/mL |
| Blocking Peptide |
For anti-Rgs10 (ARP42856_P050) antibody is Catalog # AAP42856 (Previous Catalog # AAPS10710) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q9CQE5 |
| Protein Name |
Regulator of G-protein signaling 10 |
| Protein Accession # |
NP_080694 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_026418 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Rgs10 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Pig |
| Application |
FACS, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Human: 93%; Mouse: 100%; Pig: 93%; Rat: 100% |
| Image 1 | Mouse monocytes
 | FACS -- Sample type: Bone marrow derived monocytes from mice BV2 cellsDilution: 1ug/mL |
|
| Image 2 | Mouse Thymus
 | WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Mouse Thymus |
|
