Product Number |
ARP42784_T100 |
Product Page |
www.avivasysbio.com/cox4i1-antibody-n-terminal-region-arp42784-t100.html |
Name |
COX4I1 Antibody - N-terminal region (ARP42784_T100) |
Protein Size (# AA) |
169 amino acids |
Molecular Weight |
19kDa |
Subunit |
4 isoform 1, mitochondrial |
NCBI Gene Id |
1327 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cytochrome c oxidase subunit IV isoform 1 |
Alias Symbols |
COX4, COXIV, COX4-1, COXIV-1, MC4DN16, COX IV-1 |
Peptide Sequence |
Synthetic peptide located within the following region: AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Williams,S.L., (2004) J. Biol. Chem. 279 (9), 7462-7469 |
Description of Target |
Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. |
Protein Interactions |
SDCBP; COX1; env; APP; UBC; ICT1; TMBIM4; NELFCD; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-COX4I1 (ARP42784_T100) antibody |
Blocking Peptide |
For anti-COX4I1 (ARP42784_T100) antibody is Catalog # AAP42784 (Previous Catalog # AAPS10110) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human COX4I1 |
Uniprot ID |
P13073 |
Protein Name |
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial |
Publications |
Geerling, J. J. et al. Metformin lowers plasma triglycerides by promoting VLDL-triglyceride clearance by brown adipose tissue in mice. Diabetes 63, 880-91 (2014). 24270984
Snyder, A. M. et al. Mitochondrial ferritin in the substantia nigra in restless legs syndrome. J. Neuropathol. Exp. Neurol. 68, 1193-9 (2009). 19816198 |
Sample Type Confirmation |
COX4I1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_001852 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001861 |
Tested Species Reactivity |
Human |
Gene Symbol |
COX4I1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB, IP |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86% |
Image 1 | Human Heart
| Human Heart |
|
Image 2 | Human kidney
| Human kidney |
|
Image 3 | Human, Mouse, Rat
| COX4I1 antibody - N-terminal region (ARP42784_T100) validated by WB using 1. Human liver 2. Rat liver 3. Wild-type mouse liver 4. AMPKa1+2-/- mouse liver 5. Human muscle 6. Rat muscle 7. Mouse muscle at 1:1000. |
|
Image 4 | Human
| Lanes: Lane 1: 50ug HeLa lysate Lane 2: 50ug 293T lysate Lane 3: 50ug K562 lysate Lane 4: 50ug MDA-MB-231 lysate Primary Antibody Dilution: 1:1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1:1000 Gene Name: COX4I1 Submitted by: David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences
|
|
Image 5 | Human HepG2
| WB Suggested Anti-COX4I1 Antibody Titration: 1.25ug/ml Positive Control: HepG2 cell lysateCOX4I1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
Image 6 | Human Heart
| Rabbit Anti-COX4I1 Antibody Catalog Number: ARP42784 Paraffin Embedded Tissue: Human cardiac cell Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|
Image 7 | HEK293 Whole Cell Lysate
| COX4I1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP42784_T100 with 1:200 dilution. Western blot was performed using ARP42784_T100 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: COX4I1 IP with ARP42784_T100 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate. |
|