| Product Number |
ARP42783_P050 |
| Product Page |
www.avivasysbio.com/panx1-antibody-middle-region-arp42783-p050.html |
| Name |
PANX1 Antibody - middle region (ARP42783_P050) |
| Protein Size (# AA) |
426 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
24145 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Pannexin 1 |
| Description |
|
| Alias Symbols |
PX1, MRS1, OOMD7, UNQ2529 |
| Peptide Sequence |
Synthetic peptide located within the following region: LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Otsuki,T., (2005) DNA Res. 12 (2), 117-126 |
| Description of Target |
PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties. |
| Protein Interactions |
GNAS; UBC; P2RX7; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PANX1 (ARP42783_P050) antibody |
| Blocking Peptide |
For anti-PANX1 (ARP42783_P050) antibody is Catalog # AAP42783 (Previous Catalog # AAPS10109) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PANX1 |
| Uniprot ID |
Q96RD7 |
| Protein Name |
Pannexin-1 |
| Publications |
Dietary Fatty Acids Affect Red Blood Cell Membrane Composition and Red Blood Cell ATP Release in Dairy Cows. Int J Mol Sci. 20, (2019). 31195708 |
| Sample Type Confirmation |
PANX1 is supported by BioGPS gene expression data to be expressed in HeLa |
| Protein Accession # |
NP_056183 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015368 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
PANX1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 83%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 77%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human 293T
 | Host: Rabbit
Target Name: PANX1
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml |
|
| Image 2 | Human Intestine
 | Human Intestine |
|
| Image 3 | mouse retina and mouse KO
 | Sample Type: Mouse Retina and Knockout PANX-1 Mouse Tissue |
|
| Image 4 | Human Brain
 | Rabbit Anti-PANX1 Antibody
Catalog Number: ARP42783
Paraffin Embedded Tissue: Human neural cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
