Product Number |
ARP42722_P050 |
Product Page |
www.avivasysbio.com/atg4a-antibody-middle-region-arp42722-p050.html |
Name |
ATG4A Antibody - middle region (ARP42722_P050) |
Protein Size (# AA) |
398 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
115201 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
ATG4 autophagy related 4 homolog A (S. cerevisiae) |
Alias Symbols |
APG4A, AUTL2 |
Peptide Sequence |
Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases. |
Protein Interactions |
CDKL3; GABARAPL1; GABARAPL2; ATG101; MAP1LC3B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ATG4A (ARP42722_P050) antibody |
Blocking Peptide |
For anti-ATG4A (ARP42722_P050) antibody is Catalog # AAP42722 (Previous Catalog # AAPP26434) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ATG4A |
Uniprot ID |
Q8WYN0 |
Protein Name |
Cysteine protease ATG4A |
Publications |
Identification of breast cancer cell subtypes sensitive to ATG4B inhibition. Oncotarget. 7, 66970-66988 (2016). 27556700 |
Protein Accession # |
NP_443168 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_052936 |
Tested Species Reactivity |
Human |
Gene Symbol |
ATG4A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Spleen
| WB Suggested Anti-ATG4A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Spleen |
|
|