GNAS Antibody - N-terminal region (ARP42693_P050)

• Product Number: ARP42693_P050
• Name: GNAS Antibody - N-terminal region (ARP42693_P050)
• Protein Size (# AA): 394 amino acids
• Molecular Weight: 46 kDa
• NCBI Gene Id: 2778
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: GNAS complex locus
• Alias Symbols: AHO, GSA, GSP, POH, GPSA, NESP, SCG6, SgVI, GNAS1, PITA3, C20orf45
• Peptide Sequence: Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bagchi,G., (2008) Cancer Res. 68 (9), 3225-3231
• Description of Target: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.
• Protein Interactions: PANX1; AXIN1; UBC; FUS; OPTN; PTGIR; HLA-A; ADRB2; NUCB2; NUCB1; LAMTOR1; SLC25A12; GNAQ; GNA11; UBD; TBXA2R; GNB1; AVPR2; SUMO1; PCK1; Ric8b; GNG2; CALM1; Haus1; Trim69; Cbx1; RIC8A; TTC1; SNX13; ADCY5; CRHR1; PTGDR; TSHR; CAV3; HTR6; RGS2; ADCY6; VIPR1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Additional Information: IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
  IHC Information: Thyroid, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
• Blocking Peptide: For anti-GNAS (ARP42693_P050) antibody is Catalog # AAP42693 (Previous Catalog # AAPP11574)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
• Uniprot ID: P63092
• Protein Name: Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
• Publications:

  Masyuk, A. I. et al. Ciliary subcellular localization of TGR5 determines the cholangiocyte functional response to bile acid signaling. Am. J. Physiol. Gastrointest. Liver Physiol. 304, G1013-24 (2013). 23578785

  Moreno-Smith, M. et al. Biologic effects of dopamine on tumor vasculature in ovarian carcinoma. Neoplasia 15, 502-10 (2013). 23633922

• Sample Type Confirmation:

  GNAS is strongly supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_000507
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000516
• Tested Species Reactivity: Human
• Gene Symbol: GNAS
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Lung Tumor
  
  Host: Rabbit
  Target Name: GNAS
  Sample Tissue: Human Lung Tumor
  Antibody Dilution: 1.0ug/ml
• Image 2: Human Pancreas
  
  Rabbit Anti-GNAS Antibody
  Catalog Number: arp42693
  Paraffin Embedded Tissue: Human Pancreas
  Antibody Concentration: 5 ug/ml
• Image 3: Human thyroid
  
  Anti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
• Image 4: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: GNAS
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml